HEX
Server: Apache
System: Linux beluga.o2switch.net 4.18.0-553.123.2.lve.el8.x86_64 #1 SMP Thu May 7 23:17:13 UTC 2026 x86_64
User: sc3naki1272 (1113)
PHP: 8.3.33
Disabled: NONE
Upload Files
File: //proc/self/root/proc/self/root/opt/alt/python27/lib64/python2.7/ftplib.pyc
�
�V~gc@sdZddlZddlZy5ddlZeZ[ddlmZee_[Wnek
rrddlZnXddlmZddgZdZ	dZ
d	Zd
efd��YZ
de
fd
��YZde
fd��YZde
fd��YZde
fd��YZe
eefZdZdfd��YZyddlZWnek
rZn9Xdefd��YZejd�e
eeejfZead�Zead�Zd�Z d�Z!d�Z"ddd�Z#dfd ��YZ$d!�Z%e&d"kr
e%�ndS(#sSAn FTP client class and some helper functions.

Based on RFC 959: File Transfer Protocol (FTP), by J. Postel and J. Reynolds

Example:

>>> from ftplib import FTP
>>> ftp = FTP('ftp.python.org') # connect to host, default port
>>> ftp.login() # default, i.e.: user anonymous, passwd anonymous@
'230 Guest login ok, access restrictions apply.'
>>> ftp.retrlines('LIST') # list directory contents
total 9
drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 .
drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 ..
drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 bin
drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 etc
d-wxrwxr-x   2 ftp      wheel        1024 Sep  5 13:43 incoming
drwxr-xr-x   2 root     wheel        1024 Nov 17  1993 lib
drwxr-xr-x   6 1094     wheel        1024 Sep 13 19:07 pub
drwxr-xr-x   3 root     wheel        1024 Jan  3  1994 usr
-rw-r--r--   1 root     root          312 Aug  1  1994 welcome.msg
'226 Transfer complete.'
>>> ftp.quit()
'221 Goodbye.'
>>>

A nice test that reveals some of the network dialogue would be:
python ftplib.py -d localhost -l -p -l
i����N(tgetfqdn(t_GLOBAL_DEFAULT_TIMEOUTtFTPtNetrciii tErrorcBseZRS((t__name__t
__module__(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR?sterror_replycBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR@st
error_tempcBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRAst
error_permcBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR	Bsterror_protocBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR
Css
cBs�eZdZdZdZeZeZd,Z
d,Zd,ZdZ
dddded�Zdddd�Zd�Zd�ZeZd	�Zd
�Zd�Zd�Zd
�Zd�Zd�Zd�Zd�Zd�Zd�Zd�Zd�Z d�Z!d�Z"d,d�Z#d,d�Z$dddd�Z%dd,d�Z&d,d�Z'dd,d,d�Z(d,d�Z)d �Z*d!�Z+d"�Z,d#�Z-d$�Z.d%�Z/d&�Z0d'�Z1d(�Z2d)�Z3d*�Z4d+�Z5RS(-suAn FTP client class.

    To create a connection, call the class using these arguments:
            host, user, passwd, acct, timeout

    The first four arguments are all strings, and have default value ''.
    timeout must be numeric and defaults to None if not passed,
    meaning that no timeout will be set on any ftp socket(s)
    If a timeout is passed, then this is now the default timeout for all ftp
    socket operations for this instance.

    Then use self.connect() with optional host and port argument.

    To download a file, use ftp.retrlines('RETR ' + filename),
    or ftp.retrbinary() with slightly different arguments.
    To upload a file, use ftp.storlines() or ftp.storbinary(),
    which have an open file as argument (see their definitions
    below for details).
    The download/upload functions first issue appropriate TYPE
    and PORT or PASV commands.
iticCs?||_|r;|j|�|r;|j|||�q;ndS(N(ttimeouttconnecttlogin(tselfthosttusertpasswdtacctR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt__init__ts
	
i���cCs�|dkr||_n|dkr0||_n|dkrH||_ntj|j|jf|j�|_|jj|_|jjd�|_	|j
�|_|jS(s�Connect to host.  Arguments are:
         - host: hostname to connect to (string, default previous host)
         - port: port to connect to (integer, default previous port)
        Rii���trb(RtportRtsockettcreate_connectiontsocktfamilytaftmakefiletfiletgetresptwelcome(RRRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR
|s$cCs(|jr!dG|j|j�GHn|jS(s`Get the welcome message from the server.
        (this is read and squirreled away by connect())s	*welcome*(t	debuggingtsanitizeR(R((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
getwelcome�s	cCs
||_dS(s�Set the debugging level.
        The required argument level means:
        0: no debugging output (default)
        1: print commands and responses but not body text etc.
        2: also print raw lines read and sent before stripping CR/LFN(R (Rtlevel((s+/opt/alt/python27/lib64/python2.7/ftplib.pytset_debuglevel�scCs
||_dS(s�Use passive or active mode for data transfers.
        With a false argument, use the normal PORT mode,
        With a true argument, use the PASV command.N(t
passiveserver(Rtval((s+/opt/alt/python27/lib64/python2.7/ftplib.pytset_pasv�scCs�|d dks |d dkr~t|�}x.|dkr\||ddkr\|d}q/W|d d|d||}nt|�S(Nispass sPASS is
t*(tlentrepr(Rtsti((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR!�s #!cCsid|ksd|kr'td��n|t}|jdkrUdG|j|�GHn|jj|�dS(Ns
s
s4an illegal newline character should not be containedis*put*(t
ValueErrortCRLFR R!Rtsendall(Rtline((s+/opt/alt/python27/lib64/python2.7/ftplib.pytputline�s
cCs/|jrdG|j|�GHn|j|�dS(Ns*cmd*(R R!R1(RR0((s+/opt/alt/python27/lib64/python2.7/ftplib.pytputcmd�s	cCs�|jj|jd�}t|�|jkrDtd|j��n|jdkrhdG|j|�GHn|swt�n|dtkr�|d }n|dtkr�|d }n|S(Nisgot more than %d bytess*get*i����i����(	RtreadlinetmaxlineR)RR R!tEOFErrorR.(RR0((s+/opt/alt/python27/lib64/python2.7/ftplib.pytgetline�s	

cCsx|j�}|dd!dkrt|d }xH|j�}|d|}|d |kr,|dd!dkr,Pq,q,Wn|S(Niit-s
(R6(RR0tcodetnextline((s+/opt/alt/python27/lib64/python2.7/ftplib.pytgetmultiline�s
cCs�|j�}|jr*dG|j|�GHn|d |_|d }|d	krQ|S|dkrit|�n|dkr�t|�nt|�dS(
Ns*resp*iit1t2t3t4t5(R;R<R=(R:R R!tlastrespRR	R
(Rtresptc((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s	

cCs,|j�}|d dkr(t|�n|S(s%Expect a response beginning with '2'.iR<(RR(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytvoidresp�scCsmdt}|jdkr.dG|j|�GHn|jj|t�|j�}|d d	krit|�ndS(
s�Abort a file transfer.  Uses out-of-band data.
        This does not follow the procedure from the RFC to send Telnet
        IP and Synch; that doesn't seem to work with the servers I've
        tried.  Instead, just send the ABOR command as OOB data.tABORis*put urgent*it426t225t226N(RERFRG(R.R R!RR/tMSG_OOBR:R
(RR0RA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytabort�s
cCs|j|�|j�S(s'Send a command and return the response.(R2R(Rtcmd((s+/opt/alt/python27/lib64/python2.7/ftplib.pytsendcmd�s
cCs|j|�|j�S(s8Send a command and expect a response beginning with '2'.(R2RC(RRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytvoidcmd�s
cCsY|jd�}t|d�t|d�g}||}ddj|�}|j|�S(sUSend a PORT command with the current host and the given
        port number.
        t.isPORT t,(tsplitR*tjoinRL(RRRthbytestpbytestbytesRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytsendports
 
cCs�d}|jtjkr!d}n|jtjkr<d}n|dkrTtd�ndt|�|t|�dg}ddj|�}|j|�S(sESend an EPRT command with the current host and the given port number.iiisunsupported address familyRsEPRT t|(RRtAF_INETtAF_INET6R
R*RPRL(RRRRtfieldsRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytsendeprts		!cCsqd}d}x�tjdd|jtjdtj�D]w}|\}}}}}y&tj|||�}|j|�Wn2tjk
r�}|r�|j�nd}q4nXPq4W|dkr�|dk	r�|�q�tjd��n|j	d�|j
�d}	|jj
�d}
|jtjkr9|j
|
|	�}n|j|
|	�}|jtk	rm|j|j�n|S(s3Create a new socket and send a PORT command for it.is!getaddrinfo returns an empty listiN(tNoneRtgetaddrinfoRtSOCK_STREAMt
AI_PASSIVEtbindterrortclosetlistentgetsocknameRRVRTRYRRt
settimeout(RterrRtresRtsocktypetprotot	canonnametsaRRRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytmakeports4.
	
cCsa|jtjkr0t|jd��\}}n't|jd�|jj��\}}||fS(NtPASVtEPSV(RRRVtparse227RKtparse229Rtgetpeername(RRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pytmakepasv8s'c
Cs�d}|jr�|j�\}}tj||f|j�}yn|dk	r_|jd|�n|j|�}|ddkr�|j�}n|ddkr�t|�nWq�|j	��q�Xn�|j
�}z�|dk	r�|jd|�n|j|�}|ddkr!|j�}n|ddkr=t|�n|j�\}}	|jtk	rq|j
|j�nWd|j	�X|d dkr�t|�}n||fS(s�Initiate a transfer over the data connection.

        If the transfer is active, send a port command and the
        transfer command, and accept the connection.  If the server is
        passive, send a pasv command, connect to it, and start the
        transfer command.  Either way, return the socket for the
        connection and the expected size of the transfer.  The
        expected size may be None if it could not be determined.

        Optional `rest' argument can be a string that is sent as the
        argument to a REST command.  This is essentially a server
        marker used to tell the server to skip over any data up to the
        given marker.
        sREST %siR<R;Nit150(RZR%RpRRRRKRRR`RjtacceptRRctparse150(
RRJtresttsizeRRtconnRARtsockaddr((s+/opt/alt/python27/lib64/python2.7/ftplib.pytntransfercmd?s>	

cCs|j||�dS(s0Like ntransfercmd() but returns only the socket.i(Rx(RRJRt((s+/opt/alt/python27/lib64/python2.7/ftplib.pyttransfercmdxscCs�|sd}n|sd}n|s-d}n|dkrR|dkrR|d}n|jd|�}|ddkr�|jd|�}n|ddkr�|jd	|�}n|dd
kr�t|�n|S(sLogin, default anonymous.t	anonymousRR7s
anonymous@sUSER iR=sPASS sACCT R<(RR7(RKR(RRRRRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR|s 			
i cCse|jd�|j||�}z.x'|j|�}|s>Pn||�q%WWd|j�X|j�S(s�Retrieve data in binary mode.  A new port is created for you.

        Args:
          cmd: A RETR command.
          callback: A single parameter callable to be called on each
                    block of data read.
          blocksize: The maximum number of bytes to read from the
                     socket at one time.  [default: 8192]
          rest: Passed to transfercmd().  [default: None]

        Returns:
          The response code.
        sTYPE IN(RLRytrecvR`RC(RRJtcallbackt	blocksizeRtRvtdata((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
retrbinary�s
cCs.|d
krt}n|jd�}|j|�}d
}z�|jd�}x�|j|jd�}t|�|jkr�td|j��n|j	dkr�dGt
|�GHn|s�Pn|dtkr�|d }n|dd	kr�|d }n||�qNWWd
|r|j�n|j�X|j
�S(snRetrieve data in line mode.  A new port is created for you.

        Args:
          cmd: A RETR, LIST, NLST, or MLSD command.
          callback: An optional single parameter callable that is called
                    for each line with the trailing CRLF stripped.
                    [default: print_line()]

        Returns:
          The response code.
        sTYPE ARisgot more than %d bytesis*retr*i����i����s
N(RZt
print_lineRKRyRR3R4R)RR R*R.R`RC(RRJR|RARvtfpR0((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	retrlines�s0	


cCs{|jd�|j||�}zDx=|j|�}|s>Pn|j|�|r%||�q%q%WWd|j�X|j�S(s9Store a file in binary mode.  A new port is created for you.

        Args:
          cmd: A STOR command.
          fp: A file-like object with a read(num_bytes) method.
          blocksize: The maximum data size to read from fp and send over
                     the connection at once.  [default: 8192]
          callback: An optional single parameter callable that is called on
                    each block of data after it is sent.  [default: None]
          rest: Passed to transfercmd().  [default: None]

        Returns:
          The response code.
        sTYPE IN(RLRytreadR/R`RC(RRJR�R}R|RtRvtbuf((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
storbinary�s

cCs�|jd�|j|�}z�x�|j|jd�}t|�|jkrctd|j��n|smPn|dtkr�|dtkr�|d }n|t}n|j|�|r"||�q"q"WWd|j�X|j	�S(shStore a file in line mode.  A new port is created for you.

        Args:
          cmd: A STOR command.
          fp: A file-like object with a readline() method.
          callback: An optional single parameter callable that is called on
                    each line after it is sent.  [default: None]

        Returns:
          The response code.
        sTYPE Aisgot more than %d bytesi����i����N(
RLRyR3R4R)RR.R/R`RC(RRJR�R|RvR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	storlines�s$



cCsd|}|j|�S(sSend new account name.sACCT (RL(RtpasswordRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRs
cGsBd}x|D]}|d|}q
Wg}|j||j�|S(sBReturn a list of files in a given directory (default the current).tNLSTt (R�tappend(RtargsRJtargtfiles((s+/opt/alt/python27/lib64/python2.7/ftplib.pytnlsts
cGs�d}d}|drJt|d�td�krJ|d |d}}nx%|D]}|rQ|d|}qQqQW|j||�dS(sList a directory in long form.
        By default list current directory to stdout.
        Optional last argument is callback function; all
        non-empty arguments before it are concatenated to the
        LIST command.  (This *should* only be used for a pathname.)tLISTi����RR�N(RZttypeR�(RR�RJtfuncR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pytdirs&
cCs@|jd|�}|ddkr/t|�n|jd|�S(sRename a file.sRNFR iR=sRNTO (RKRRL(RtfromnamettonameRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytrename$scCs4|jd|�}|d dkr'|St|�dS(sDelete a file.sDELE it250t200N(R�R�(RKR(RtfilenameRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytdelete+scCs|dkrSy|jd�SWqhtk
rO}|jdd dkrP�qPqhXn|dkrhd}nd|}|j|�S(	sChange to a directory.s..tCDUPiit500RRMsCWD (RLR	R�(RtdirnametmsgRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytcwd3s
	
cCsi|jd|�}|d dkre|dj�}yt|�SWqettfk
rat|�SXndS(sRetrieve the size of a file.sSIZE it213N(RKtstriptintt
OverflowErrorR-tlong(RR�RAR+((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRu@scCs|jd|�}t|�S(s+Make a directory, return its full pathname.sMKD (RKtparse257(RR�RA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytmkdKscCs|jd|�S(sRemove a directory.sRMD (RL(RR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pytrmdPscCs|jd�}t|�S(s!Return current working directory.tPWD(RKR�(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytpwdTscCs|jd�}|j�|S(sQuit, and close the connection.tQUIT(RLR`(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytquitYs
cCsbz/|j}d|_|dk	r.|j�nWd|j}d|_|dk	r]|j�nXdS(s8Close the connection without assuming anything about it.N(RRZR`R(RRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR`_s				N(6RRt__doc__R RtFTP_PORTRtMAXLINER4RZRRRR%RRR
R"R$tdebugR'R!R1R2R6R:RRCRIRKRLRTRYRjRpRxRyRRR�R�R�RR�R�R�R�R�RuR�R�R�R�R`(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyROsb										
					
	
		9$							
					tFTP_TLSc
Bs�eZdZejZddddd
d
d
ed
d�	Zddde	d�Z
d�Zd�Zd�Z
d
d�Zdd
d	�Zd
d
�Zdd
d
d�Zd
d�ZRS(s�A FTP subclass which adds TLS support to FTP as described
        in RFC-4217.

        Connect as usual to port 21 implicitly securing the FTP control
        connection before authenticating.

        Securing the data connection requires user to explicitly ask
        for it by calling prot_p() method.

        Usage example:
        >>> from ftplib import FTP_TLS
        >>> ftps = FTP_TLS('ftp.python.org')
        >>> ftps.login()  # login anonymously previously securing control channel
        '230 Guest login ok, access restrictions apply.'
        >>> ftps.prot_p()  # switch to secure data connection
        '200 Protection level set to P'
        >>> ftps.retrlines('LIST')  # list directory content securely
        total 9
        drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 .
        drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 ..
        drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 bin
        drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 etc
        d-wxrwxr-x   2 ftp      wheel        1024 Sep  5 13:43 incoming
        drwxr-xr-x   2 root     wheel        1024 Nov 17  1993 lib
        drwxr-xr-x   6 1094     wheel        1024 Sep 13 19:07 pub
        drwxr-xr-x   3 root     wheel        1024 Jan  3  1994 usr
        -rw-r--r--   1 root     root          312 Aug  1  1994 welcome.msg
        '226 Transfer complete.'
        >>> ftps.quit()
        '221 Goodbye.'
        >>>
        Rc

Cs�|dk	r'|dk	r'td��n|dk	rN|dk	rNtd��n||_||_|dkr�tj|jd|d|�}n||_t|_	t
j||||||�dS(Ns4context and keyfile arguments are mutually exclusives5context and certfile arguments are mutually exclusivetcertfiletkeyfile(RZR-R�R�tsslt_create_stdlib_contexttssl_versiontcontexttFalset_prot_pRR(
RRRRRR�R�R�Rtsource_address((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s				cCs?|r)t|jtj�r)|j�ntj||||�S(N(t
isinstanceRR�t	SSLSockettauthRR(RRRRtsecure((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s
cCs�t|jtj�r$td��n|jtjkrH|jd�}n|jd�}|jj	|jd|j
�|_|jjdd�|_|S(s2Set up secure control connection by using TLS/SSL.sAlready using TLSsAUTH TLSsAUTH SSLtserver_hostnametmodeR(
R�RR�R�R-R�tPROTOCOL_SSLv23RLR�twrap_socketRRR(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR��scCs)|jd�|jd�}t|_|S(sSet up secure data connection.sPBSZ 0sPROT P(RLtTrueR�(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytprot_p�s
	cCs|jd�}t|_|S(s"Set up clear text data connection.sPROT C(RLR�R�(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytprot_c�s	cCsLtj|||�\}}|jrB|jj|d|j�}n||fS(NR�(RRxR�R�R�R(RRJRtRvRu((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRx�s
	i cCs�|jd�|j||�}zMx'|j|�}|s>Pn||�q%Wt|tj�rk|j�nWd|j�X|j�S(NsTYPE I(	RLRyR{R�R�R�tunwrapR`RC(RRJR|R}RtRvR~((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s
cCs>|dkrt}n|jd�}|j|�}|jd�}z�x�|j|jd�}t|�|jkr�td|j��n|j	dkr�dGt
|�GHn|s�Pn|dtkr�|d }n|dd	kr�|d }n||�qHWt|t
j�r|j�nWd|j�|j�X|j�S(
NsTYPE ARisgot more than %d bytesis*retr*i����i����s
(RZR�RKRyRR3R4R)RR R*R.R�R�R�R�R`RC(RRJR|RARvR�R0((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR��s0	


cCs�|jd�|j||�}zcx=|j|�}|s>Pn|j|�|r%||�q%q%Wt|tj�r�|j�nWd|j�X|j	�S(NsTYPE I(
RLRyR�R/R�R�R�R�R`RC(RRJR�R}R|RtRvR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s

cCs|jd�|j|�}z�x�|j|jd�}t|�|jkrctd|j��n|smPn|dtkr�|dtkr�|d }n|t}n|j|�|r"||�q"q"Wt|t	j
�r�|j�nWd|j�X|j
�S(NsTYPE Aisgot more than %d bytesi����i����(RLRyR3R4R)RR.R/R�R�R�R�R`RC(RRJR�R|RvR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s(



N(RRR�R�R�R�RZRRR�RR�R�R�RxRR�R�R�(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�qs 		
		cCs�|d dkrt|�ntdkrLddl}|jd|j�antj|�}|sedS|jd�}yt|�SWnt	t
fk
r�t|�SXdS(s�Parse the '150' response for a RETR request.
    Returns the expected transfer size or None; size is not guaranteed to
    be present in the 150 message.
    iRqi����Ns150 .* \((\d+) bytes\)i(Rt_150_reRZtretcompilet
IGNORECASEtmatchtgroupR�R�R-R�(RAR�tmR+((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRs-scCs�|d dkrt|�ntdkrFddl}|jd�antj|�}|sgt|�n|j�}dj|d �}t	|d�d>t	|d	�}||fS(
s�Parse the '227' response for a PASV request.
    Raises error_proto if it does not contain '(h1,h2,h3,h4,p1,p2)'
    Return ('host.addr.as.numbers', port#) tuple.it227i����Ns#(\d+),(\d+),(\d+),(\d+),(\d+),(\d+)RMiii(
Rt_227_reRZR�R�tsearchR
tgroupsRPR�(RAR�R�tnumbersRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRmDs"cCs�|d dkrt|�n|jd�}|dkrCt|�n|jd|d�}|dkrqt|�n||d||dkr�t|�n||d|!j||d�}t|�dkr�t|�n|d}t|d�}||fS(s�Parse the '229' response for an EPSV request.
    Raises error_proto if it does not contain '(|||port|)'
    Return ('host.addr.as.numbers', port#) tuple.it229t(it)ii(RtfindR
ROR)R�(RAtpeertlefttrighttpartsRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRnXs "
cCs�|d dkrt|�n|dd!dkr3dSd}d}t|�}xg||kr�||}|d}|dkr�||ks�||dkr�Pn|d}n||}qNW|S(s�Parse the '257' response for a MKD or PWD request.
    This is a response to a MKD or PWD request: a directory name.
    Returns the directoryname in the 257 reply.it257is "Rit"(RR)(RAR�R,tnRB((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�ns 


cCs	|GHdS(s+Default retrlines callback to print a line.N((R0((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR��sRtIc	Cs�|s|}nd|}|j|�|j|�t|jd��\}}|j||�|jd|�}|d d	kr�t�n|jd|�}|d d
kr�t�n|j�|j�dS(s+Copy file from one FTP-instance to another.sTYPE RksSTOR it125RqsRETR N(R�Rq(R�Rq(RLRmRKRTR
RC(	tsourcet
sourcenamettargett
targetnameR�t
sourcehostt
sourceportttreplytsreply((s+/opt/alt/python27/lib64/python2.7/ftplib.pytftpcp�s	


		
cBsPeZdZdZdZdZdd�Zd�Zd�Z	d�Z
d�ZRS(s�Class to parse & provide access to 'netrc' format files.

    See the netrc(4) man page for information on the file format.

    WARNING: This class is obsolete -- use module netrc instead.

    cCs|dkrFdtjkr:tjjtjdd�}qFtd�ni|_i|_t|d�}d}x�|j	|j
d�}t|�|j
kr�td|j
��n|s�Pn|r�|j
�r�|j|�qpn"|rt|�|j|<d}n|j�}d}}	}
}d}d}
x.|
t|�kr\||
}|
dt|�krr||
d}nd}|dkr�d}n�|d	kr�|r�|j�}|
d}
n�|d
kr�|r�|}	|
d}
nr|dkr|r|}
|
d}
nM|dkr'|r'|}|
d}
n(|d
krO|rO|}g}d}Pn|
d}
q/W|r�|	po|j|_|
p�|j|_|p�|j|_n|rp||jkr�|j|\}}}|	p�|}	|
p�|}
|p�|}n|	|
|f|j|<qpqpW|j�dS(NtHOMEs.netrcs!specify file to load or set $HOMEtriisgot more than %d bytestdefaulttmachineRR�taccounttmacdef(RZtostenvirontpathRPtIOErrort
_Netrc__hostst_Netrc__macrostopenR3R4R)RR�R�ttupleROtlowert_Netrc__defusert_Netrc__defpasswdt_Netrc__defacctR`(RR�R�tin_macroR0tmacro_linest
macro_nametwordsRRRRR�R,tw1tw2tousertopasswdtoacct((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s~			
	
	



cCs
|jj�S(s4Return a list of hosts mentioned in the .netrc file.(R�tkeys(R((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	get_hosts�scCs||j�}d}}}||jkrB|j|\}}}n|pN|j}|p]|j}|pl|j}|||fS(s�Returns login information for the named host.

        The return value is a triple containing userid,
        password, and the accounting field.

        N(R�RZR�R�R�R�(RRRRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pytget_account�scCs
|jj�S(s)Return a list of all defined macro names.(R�R(R((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
get_macrosscCs|j|S(s6Return a sequence of lines which define a named macro.(R�(Rtmacro((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	get_macrosN(RRR�RZR�R�R�RRRRR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�sC			cCs4ttj�dkr-tjGHtjd�nd}d}x+tjddkrf|d}tjd=q<Wtjdd dkr�tjdd}tjd=ntjd}t|�}|j|�d}}}yt	|�}Wn0t
k
r|dk	rStjjd�qSnAXy|j
|�\}}}Wn!tk
rRtjjd�nX|j|||�x�tjdD]�}|d d	kr�|j|d�qt|d dkr�d
}	|dr�|	d|d}	n|j|	�}
qt|dkr|j|j�qt|jd
|tjjd�qtW|j�dS(s�Test program.
    Usage: ftp [-d] [-r[file]] host [-l[dir]] [-d[dir]] [-p] [file] ...

    -d dir
    -l list
    -p password
    iiis-ds-rRs5Could not open account file -- using anonymous login.s$No account -- using anonymous login.s-ltCWDR�s-psRETR iN(R)tsystargvttestR�texitRZRR$RR�tstderrtwriteRtKeyErrorRR�RKR'R%RtstdoutR�(R trcfileRtftptuseridRRtnetrcRRJRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR
sN	





	

t__main__('R�R�R	tSOCKSRRtImportErrorRt__all__RHR�R�t	ExceptionRRRR	R
R�R5t
all_errorsR.RR�R�R�tSSLErrorRZR�RsR�RmRnR�R�R�RRR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt<module>sZ
	
��
�
					m	7